면역 및 흉선 펩타이드 재고 있음

LL-37

LL-37 is a high-purity research-grade compound manufactured under controlled quality conditions for pharmaceutical research applications. Available specification: 5 mg. This product is intended exclusively for research purposes and as a pharmaceutical raw material for qualified institutions.

사양

CAS 번호 N/A
분자 공식 C205H340N60O53
분자량 4493.33 g/mol
시퀀스 길이 37 amino acids

패키징 옵션

견적은 일반적으로 영업일 기준 12시간 이내에 제공됩니다.
모든 배치에 대한 COA
HPLC + MS 포함
24-48시간 이내 배송
콜드 체인 배송

제품 개요

LL-37 is classified as a synthetic peptide within the category of pharmaceutical-grade research materials. This product is manufactured to meet stringent quality specifications established for biochemical research reagents and pharmaceutical raw materials.

구조적 특성

From a structural perspective, LL-37 is derived from Human cathelicidin antimicrobial peptide. The primary structure comprises 37 amino acid residues with the sequence: [LL-37, 37 aa] The molecular formula is C205H340N60O53 with a calculated molecular weight of 4493.33 g/mol. The peptide adopts a amphipathic α-helical configuration. Distinguished structural features include: Cationic antimicrobial peptide.

제조 및 정제

합성 방법 Fmoc 보호 아미노산을 이용한 고상 펩타이드 합성(SPPS)
정화 C18 고정상, 물/아세토니트릴 그라데이션이 있는 전처리 RP-HPLC
최종 처리 멸균 여과(0.22 μm) 및 제어 동결 건조

품질 관리 테스트

정체성 ESI-MS 또는 MALDI-TOF 질량 분석법 확인
순도 RP-HPLC 분석 ≥99%
구성 산 가수분해 후 아미노산 분석
수분 함량 칼 피셔 적정 <3%
내독소 LAL 방식 <0.5 EU/mg
문서 각 로트와 함께 제공되는 분석 인증서(COA)

보관 및 취급

동결 건조 분말

  • 20°C ± 5°C에서 보관
  • 빛과 습기로부터 보호
  • 제대로 보관하면 24개월 동안 안정적으로 유지

재구성된 솔루션

  • 단기: 최대 7일간 2~8°C
  • 장기: 최대 30일간 -20°C에서 사용
  • 동결-해동 주기를 최소화하는 알리쿼트

배송

  • 2-8°C에서 콜드체인 운송
  • 장거리 운송 시 드라이아이스 권장
  • 온도 모니터링 포함

연구 애플리케이션

LL-37 is positioned within the pharmaceutical supply chain as a pharmaceutical-grade API intermediate suitable for in vitro investigational studies, assay development, analytical reference standard applications, and formulation development research. The product serves pharmaceutical research and development programs requiring characterized peptide materials with documented purity, identity, and quality specifications. Typical applications include receptor binding studies, structure-activity relationship investigations, analytical method development and validation, stability studies, and pharmaceutical formulation research. This compound is supplied exclusively for research purposes and as a pharmaceutical raw material to qualified institutions, academic laboratories, and licensed manufacturers operating under applicable regulatory frameworks. Distribution is restricted to organizations with appropriate handling capabilities and regulatory authorizations. Not intended for human or veterinary diagnostic or therapeutic use.

일반적인 애플리케이션은 다음과 같습니다: 수용체 결합 연구, 구조-활성 관계 연구, 분석 방법 개발, 안정성 연구, 의약품 제형 연구.

연구용으로만 사용하세요. 이 제품은 연구 및 제약 원료 용도로만 사용됩니다. 사람 또는 동물의 진단 또는 치료용으로 사용할 수 없습니다. 해당 안전 지침 및 규정에 따라 취급하세요.

제품 이름LL-37
CAS 번호N/A
분자 공식C205H340N60O53
분자량4493.33 g/mol
시퀀스 길이37 amino acids
물리적 외관흰색에서 회백색 동결 건조
용해성멸균수, PBS에 용해 가능
순도(HPLC)≥99%(HPLC 기준)
보관 조건빛으로부터 보호되는 -20°C ± 5°C
권장되는 재구성 프로토콜은 무엇인가요?
바이알이 실온에 도달할 때까지 기다립니다. 멸균수 또는 살균수를 원하는 농도로 추가합니다. 녹을 때까지 부드럽게 저어줍니다. 교반하지 마십시오.
펩타이드는 어떻게 보관해야 하나요?
동결 건조: -20°C, 빛으로부터 보호, 24개월 안정. 재구성: 2-8°C에서 7일간 또는 -20°C에서 30일간 전량 보관.
어떤 문서가 제공되나요?
HPLC 크로마토그램, MS 스펙트럼, 아미노산 분석, 수분 함량 및 내독소 테스트 결과를 포함한 전체 COA.
대량 구매를 제공하나요?
예. 그램 이상의 수량은 문의해 주세요. 맞춤형 합성도 가능합니다.

맞춤 견적이 필요하신가요?

대량 주문에 대한 경쟁력 있는 가격을 확인하세요. 저희 팀은 영업일 기준 12시간 이내에 답변해 드립니다.

영업팀에 문의

견적 요청

제품: LL-37