LL-37
LL-37 is a high-purity research-grade compound manufactured under controlled quality conditions for pharmaceutical research applications. Available specification: 5 mg. This product is intended exclusively for research purposes and as a pharmaceutical raw material for qualified institutions.
사양
| CAS 번호 | N/A |
|---|---|
| 분자 공식 | C205H340N60O53 |
| 분자량 | 4493.33 g/mol |
| 시퀀스 길이 | 37 amino acids |
패키징 옵션
제품 개요
LL-37 is classified as a synthetic peptide within the category of pharmaceutical-grade research materials. This product is manufactured to meet stringent quality specifications established for biochemical research reagents and pharmaceutical raw materials.
구조적 특성
From a structural perspective, LL-37 is derived from Human cathelicidin antimicrobial peptide. The primary structure comprises 37 amino acid residues with the sequence: [LL-37, 37 aa] The molecular formula is C205H340N60O53 with a calculated molecular weight of 4493.33 g/mol. The peptide adopts a amphipathic α-helical configuration. Distinguished structural features include: Cationic antimicrobial peptide.
제조 및 정제
| 합성 방법 | Fmoc 보호 아미노산을 이용한 고상 펩타이드 합성(SPPS) |
|---|---|
| 정화 | C18 고정상, 물/아세토니트릴 그라데이션이 있는 전처리 RP-HPLC |
| 최종 처리 | 멸균 여과(0.22 μm) 및 제어 동결 건조 |
품질 관리 테스트
| 정체성 | ESI-MS 또는 MALDI-TOF 질량 분석법 확인 |
|---|---|
| 순도 | RP-HPLC 분석 ≥99% |
| 구성 | 산 가수분해 후 아미노산 분석 |
| 수분 함량 | 칼 피셔 적정 <3% |
| 내독소 | LAL 방식 <0.5 EU/mg |
| 문서 | 각 로트와 함께 제공되는 분석 인증서(COA) |
보관 및 취급
동결 건조 분말
- 20°C ± 5°C에서 보관
- 빛과 습기로부터 보호
- 제대로 보관하면 24개월 동안 안정적으로 유지
재구성된 솔루션
- 단기: 최대 7일간 2~8°C
- 장기: 최대 30일간 -20°C에서 사용
- 동결-해동 주기를 최소화하는 알리쿼트
배송
- 2-8°C에서 콜드체인 운송
- 장거리 운송 시 드라이아이스 권장
- 온도 모니터링 포함
연구 애플리케이션
LL-37 is positioned within the pharmaceutical supply chain as a pharmaceutical-grade API intermediate suitable for in vitro investigational studies, assay development, analytical reference standard applications, and formulation development research. The product serves pharmaceutical research and development programs requiring characterized peptide materials with documented purity, identity, and quality specifications. Typical applications include receptor binding studies, structure-activity relationship investigations, analytical method development and validation, stability studies, and pharmaceutical formulation research. This compound is supplied exclusively for research purposes and as a pharmaceutical raw material to qualified institutions, academic laboratories, and licensed manufacturers operating under applicable regulatory frameworks. Distribution is restricted to organizations with appropriate handling capabilities and regulatory authorizations. Not intended for human or veterinary diagnostic or therapeutic use.
일반적인 애플리케이션은 다음과 같습니다: 수용체 결합 연구, 구조-활성 관계 연구, 분석 방법 개발, 안정성 연구, 의약품 제형 연구.
연구용으로만 사용하세요. 이 제품은 연구 및 제약 원료 용도로만 사용됩니다. 사람 또는 동물의 진단 또는 치료용으로 사용할 수 없습니다. 해당 안전 지침 및 규정에 따라 취급하세요.
| 제품 이름 | LL-37 |
|---|---|
| CAS 번호 | N/A |
| 분자 공식 | C205H340N60O53 |
| 분자량 | 4493.33 g/mol |
| 시퀀스 길이 | 37 amino acids |
| 물리적 외관 | 흰색에서 회백색 동결 건조 |
| 용해성 | 멸균수, PBS에 용해 가능 |
| 순도(HPLC) | ≥99%(HPLC 기준) |
| 보관 조건 | 빛으로부터 보호되는 -20°C ± 5°C |
맞춤 견적이 필요하신가요?
대량 주문에 대한 경쟁력 있는 가격을 확인하세요. 저희 팀은 영업일 기준 12시간 이내에 답변해 드립니다.