Immune & Thymic Peptides In Stock

LL-37

LL-37 is a high-purity research-grade compound manufactured under controlled quality conditions for pharmaceutical research applications. Available specification: 5 mg. This product is intended exclusively for research purposes and as a pharmaceutical raw material for qualified institutions.

Specifications

CAS Number N/A
Molecular Formula C205H340N60O53
Molecular Weight 4493.33 g/mol
Sequence Length 37 amino acids

Packaging Options

Quotes typically provided within 12 business hours.
COA with every batch
HPLC + MS included
Ships within 24-48h
Cold chain shipping

Product Overview

LL-37 is classified as a synthetic peptide within the category of pharmaceutical-grade research materials. This product is manufactured to meet stringent quality specifications established for biochemical research reagents and pharmaceutical raw materials.

Structural Characteristics

From a structural perspective, LL-37 is derived from Human cathelicidin antimicrobial peptide. The primary structure comprises 37 amino acid residues with the sequence: [LL-37, 37 aa] The molecular formula is C205H340N60O53 with a calculated molecular weight of 4493.33 g/mol. The peptide adopts a amphipathic α-helical configuration. Distinguished structural features include: Cationic antimicrobial peptide.

Manufacturing & Purification

Synthesis Method Solid-phase peptide synthesis (SPPS) using Fmoc-protected amino acids
Purification Preparative RP-HPLC with C18 stationary phase, water/acetonitrile gradient
Final Processing Sterile filtration (0.22 μm) and controlled lyophilization

Quality Control Testing

Identity ESI-MS or MALDI-TOF mass spectrometry confirmation
Purity RP-HPLC analysis ≥99%
Composition Amino acid analysis following acid hydrolysis
Water Content Karl Fischer titration <3%
Endotoxin LAL method <0.5 EU/mg
Documentation Certificate of Analysis (COA) provided with each lot

Storage & Handling

Lyophilized Powder

  • Store at -20°C ± 5°C
  • Protected from light and moisture
  • Stable for 24 months when properly stored

Reconstituted Solution

  • Short-term: 2-8°C for up to 7 days
  • Long-term: -20°C for up to 30 days
  • Aliquot to minimize freeze-thaw cycles

Shipping

  • Cold chain transport at 2-8°C
  • Dry ice recommended for extended transit
  • Temperature monitoring included

Research Applications

LL-37 is positioned within the pharmaceutical supply chain as a pharmaceutical-grade API intermediate suitable for in vitro investigational studies, assay development, analytical reference standard applications, and formulation development research. The product serves pharmaceutical research and development programs requiring characterized peptide materials with documented purity, identity, and quality specifications. Typical applications include receptor binding studies, structure-activity relationship investigations, analytical method development and validation, stability studies, and pharmaceutical formulation research. This compound is supplied exclusively for research purposes and as a pharmaceutical raw material to qualified institutions, academic laboratories, and licensed manufacturers operating under applicable regulatory frameworks. Distribution is restricted to organizations with appropriate handling capabilities and regulatory authorizations. Not intended for human or veterinary diagnostic or therapeutic use.

Typical applications include: Receptor binding studies, structure-activity relationship investigations, analytical method development, stability studies, and pharmaceutical formulation research.

For Research Use Only. This product is intended for research and pharmaceutical raw material applications only. Not for human or veterinary diagnostic or therapeutic use. Handle according to applicable safety guidelines and regulations.

Product NameLL-37
CAS NumberN/A
Molecular FormulaC205H340N60O53
Molecular Weight4493.33 g/mol
Sequence Length37 amino acids
Physical AppearanceWhite to off-white lyophilized
SolubilitySoluble in sterile water, PBS
Purity (HPLC)≥99% (by HPLC)
Storage Conditions-20°C ± 5°C, protected from light
What is the recommended reconstitution protocol?
Allow vial to reach room temperature. Add sterile water or bacteriostatic water to desired concentration. Gently swirl until dissolved. Do not vortex.
How should I store the peptide?
Lyophilized: -20°C, protected from light, stable 24 months. Reconstituted: 2-8°C for 7 days, or -20°C for 30 days in aliquots.
What documentation is provided?
Full COA with HPLC chromatogram, MS spectrum, amino acid analysis, water content, and endotoxin testing results.
Do you offer bulk quantities?
Yes. Contact us for gram+ quantities. Custom synthesis also available.

Need a Custom Quote?

Get competitive pricing for bulk orders. Our team responds within 12 business hours.

Contact Sales

Request Quote

Product: LL-37