LL-37
LL-37 is a high-purity research-grade compound manufactured under controlled quality conditions for pharmaceutical research applications. Available specification: 5 mg. This product is intended exclusively for research purposes and as a pharmaceutical raw material for qualified institutions.
Specifications
| CAS Number | N/A |
|---|---|
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4493.33 g/mol |
| Sequence Length | 37 amino acids |
Packaging Options
Product Overview
LL-37 is classified as a synthetic peptide within the category of pharmaceutical-grade research materials. This product is manufactured to meet stringent quality specifications established for biochemical research reagents and pharmaceutical raw materials.
Structural Characteristics
From a structural perspective, LL-37 is derived from Human cathelicidin antimicrobial peptide. The primary structure comprises 37 amino acid residues with the sequence: [LL-37, 37 aa] The molecular formula is C205H340N60O53 with a calculated molecular weight of 4493.33 g/mol. The peptide adopts a amphipathic α-helical configuration. Distinguished structural features include: Cationic antimicrobial peptide.
Manufacturing & Purification
| Synthesis Method | Solid-phase peptide synthesis (SPPS) using Fmoc-protected amino acids |
|---|---|
| Purification | Preparative RP-HPLC with C18 stationary phase, water/acetonitrile gradient |
| Final Processing | Sterile filtration (0.22 μm) and controlled lyophilization |
Quality Control Testing
| Identity | ESI-MS or MALDI-TOF mass spectrometry confirmation |
|---|---|
| Purity | RP-HPLC analysis ≥99% |
| Composition | Amino acid analysis following acid hydrolysis |
| Water Content | Karl Fischer titration <3% |
| Endotoxin | LAL method <0.5 EU/mg |
| Documentation | Certificate of Analysis (COA) provided with each lot |
Storage & Handling
Lyophilized Powder
- Store at -20°C ± 5°C
- Protected from light and moisture
- Stable for 24 months when properly stored
Reconstituted Solution
- Short-term: 2-8°C for up to 7 days
- Long-term: -20°C for up to 30 days
- Aliquot to minimize freeze-thaw cycles
Shipping
- Cold chain transport at 2-8°C
- Dry ice recommended for extended transit
- Temperature monitoring included
Research Applications
LL-37 is positioned within the pharmaceutical supply chain as a pharmaceutical-grade API intermediate suitable for in vitro investigational studies, assay development, analytical reference standard applications, and formulation development research. The product serves pharmaceutical research and development programs requiring characterized peptide materials with documented purity, identity, and quality specifications. Typical applications include receptor binding studies, structure-activity relationship investigations, analytical method development and validation, stability studies, and pharmaceutical formulation research. This compound is supplied exclusively for research purposes and as a pharmaceutical raw material to qualified institutions, academic laboratories, and licensed manufacturers operating under applicable regulatory frameworks. Distribution is restricted to organizations with appropriate handling capabilities and regulatory authorizations. Not intended for human or veterinary diagnostic or therapeutic use.
Typical applications include: Receptor binding studies, structure-activity relationship investigations, analytical method development, stability studies, and pharmaceutical formulation research.
For Research Use Only. This product is intended for research and pharmaceutical raw material applications only. Not for human or veterinary diagnostic or therapeutic use. Handle according to applicable safety guidelines and regulations.
| Product Name | LL-37 |
|---|---|
| CAS Number | N/A |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4493.33 g/mol |
| Sequence Length | 37 amino acids |
| Physical Appearance | White to off-white lyophilized |
| Solubility | Soluble in sterile water, PBS |
| Purity (HPLC) | ≥99% (by HPLC) |
| Storage Conditions | -20°C ± 5°C, protected from light |
Need a Custom Quote?
Get competitive pricing for bulk orders. Our team responds within 12 business hours.